Contenido principal

Aligning Pairs of Sequences

This example shows how to extract some sequences from GenBank® and align the sequences using global and local alignment algorithms.

Accessing NCBI Data from the MATLAB® Workspace

One of the many fascinating sections of the NCBI web site is the Genes and diseases section. This section provides a comprehensive introduction to medical genetics.

In this example you will be looking at genes associated with Tay-Sachs Disease. Tay-Sachs is an autosomal recessive disease caused by mutations in both alleles of a gene (HEXA, which codes for the alpha subunit of hexosaminidase A) on chromosome 15.

The NCBI reference sequence for HEXA has accession number NM_000520. You can use the getgenbank function to retrieve the sequence information from the NCBI data repository and load it into MATLAB®.

humanHEXA = getgenbank('NM_000520');

By doing a BLAST search or by searching in the mouse genome you can find an orthogonal gene, AK080777 is the accession number for a mouse hexosaminidase A gene.

mouseHEXA = getgenbank('AK080777');

For your convenience, previously downloaded sequences are included in a MAT-file. Note that data in public repositories is frequently curated and updated; therefore the results of this example might be slightly different when you use up-to-date datasets.

load('hexosaminidase.mat','humanHEXA','mouseHEXA')

Aligning the Sequences

The first step is to use global sequence alignment to look for similarities between these sequences. You could look at the alignment between the nucleotide sequences, but it is generally more instructive to look at the alignment between the protein sequences, in this example we know that the sequences are coding sequences. Use the nt2aa function to convert the nucleotide sequences into the corresponding amino acid sequences.

humanProtein = nt2aa(humanHEXA.Sequence);
mouseProtein = nt2aa(mouseHEXA.Sequence);

One of the easiest ways to look for similarity between sequences is with a dot plot.

seqdotplot(mouseProtein,humanProtein)
Warning: Match matrix has more points than available screen pixels.
         Scaling image by factors of 1 in X and 2 in Y.
xlabel('Human hexosaminidase A');ylabel('Mouse hexosaminidase A');

Figure contains an axes object. The axes object with xlabel Human hexosaminidase A, ylabel Mouse hexosaminidase A contains an object of type image.

With the default settings, the dot plot is a little difficult to interpret, so you can try a slightly more stringent dot plot.

seqdotplot(mouseProtein,humanProtein,4,3)
Warning: Match matrix has more points than available screen pixels.
         Scaling image by factors of 1 in X and 2 in Y.
xlabel('Human hexosaminidase A');ylabel('Mouse hexosaminidase A');

Figure contains an axes object. The axes object with xlabel Human hexosaminidase A, ylabel Mouse hexosaminidase A contains an object of type image.

The diagonal line indicates that there is probably a good alignment so you can now take a look at the global alignment using the function nwalign which uses the Needleman-Wunsch algorithm.

[score, globalAlignment] = nwalign(humanProtein,mouseProtein)
score = 
634.3333
globalAlignment = 3×812 char array
    'SCRRPAQSAARSRSLRSRPEVKGQGVGPPGVAGAEPPLVT*FADKSRGRRSPDQGLTWPAPSERGDQRAMTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGFCEQEFEQT*APGTEEGAGCR*MVVEPGFHCILARGRSPLPSCPLPACPCAWRERGRCWRSHSIKSNVAFFYNKHGLPVFKKKSVNGVRVRAQPGWSQCLPLRSFKLRAGNETYSLCAVLPCL*AMSLPSHS*PYSRHLP*SSACSLHFCIISPRRWYMEKDVGAWRCSGQWGGLQTQPGHRRASPPCILIHLPPLELFSFGFLAASILYNHYLNIIKHILFS'
    '        ||            |:        |         |    | |       |          ||:: ||| |||||||:|  ||||||||| :||  :||:||||||||:| |||||| || ||||||:|||:||||||||||| :::|::|| ||:|||||||  ||::|:|||||||||||||||||| |||||||||||||||||||||||||||||||:|:|||||||||:|||||||||||||||||||||||||:|||||||||| |||||||||||| ||||:|||||||||||||||||||||||||||||||||||||||||| |||||||||||: ||||||||||||:||:||||:|||:|||||||||||||||||||||||||:|| ||:||||  ||||||||||||||||||:| |||||||||||||||::||||||||||::||:|| |:: :|:|||||||||||||||::|||||||:| ||||||:||||||||||||||||||||||:||||||||||||||||||||::||::: ||::|||||||||:|||:||||::|| ||||||||||  |  :|  :    :||       |      |    ||           |: ::   |        |   :: |  : :| :    | :|  : :   |  :::         | | |::|   :   |    |    |  :|     ||::||    |   |:  |    |                       | :: |:       |  '
    '--------AA------------GR--------G---------A----G-R-------W----------AMAGCRLWVSLLLAAALACLATALWPWPQYIQTYHRRYTLYPNNFQFRYHVSSAAQAGCVVLDEAFRRYRNLLFGSGSWPRPSFSNKQQTLGKNILVVSVVTAECNEFPNLESVENYTLTINDDQCLLASETVWGALRGLETFSQLVWKSAEGTFFINKTKIKDFPRFPHRGVLLDTSRHYLPLSSILDTLDVMAYNKFNVFHWHLVDDSSFPYESFTFPELTRKGSFNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGAPGLLTPCYSGSHLSGTFGPVNPSLNSTYDFMSTLFLEISSVFPDFYLHLGGDEVDFTCWKSNPNIQAFMKKKGF-TDFKQLESFYIQTLLDIVSDYDKGYVVWQEVFDNKVKVRPDTIIQVWREEMPVEYMLEMQDITRAGFRALLSAPWYLNRVKYGPDWKDMYKVEPLAFHGTPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLWSSNLTTNIDFAFKRLSHFRCELVRRGIQAQPISVGCCEQEFEQT*A--T--SA--E----HPG-------G------C----CP---------L-SQ-LR--*A--------P---RR-V--LALR-E----Q-VP--G-Q---G-*SFT---------A-SRPGES---T---P----CP---C--APVT--TEKEAGA----GT--GV--Q---*R-----------------------S-MW-HF-------L--'

Refining With Semi-global Alignment

The alignment is very good except for the terminal segments. For instance, notice the sparse matched pairs in the first positions. This occurs because a global alignment attempts to force the matching all the way to the ends and there is point where the penalty for opening new gaps is comparable to the score of matching residues. In some cases it is desirable to remove the gap penalty added at the ends of a global alignment; this allows you to better match this pair of sequences. This technique is commonly known as 'semi-global' alignment or 'glocal' alignment.

[score, globalAlignment] = nwalign(humanProtein,mouseProtein,'glocal',true)
score = 
1.0413e+03
globalAlignment = 3×825 char array
    'SCRRPAQSAARSRSLRSRPEVKGQGVGPPGVAGAEPPLVT*FADKSRGRRSPDQGLTWPAPSERGDQR-AMTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGFCEQEFEQT*APGTEEGAGCR*MV-VEPGFHCILA-R----GR--SPLPSCP-LPA-CPCA-WRERGRCWRSHSIK-SNVAFFYNKHGLPVFKKKSVNGVRVRAQPGWSQCLPLRSFKLRAGNETYSLCAVLPCL*AMSLPSHS*PYSRHLP*SSACSLHFCIISPRRWYMEKDVGAWRCSGQWGGLQTQPGHRRASPPCILIHLPPLELFSFGFLAASILYNHYLNIIKHILFS'
    '                                                             : ||  | ||:: ||| |||||||:|  ||||||||| :||  :||:||||||||:| |||||| || ||||||:|||:||||||||||| :::|::|| ||:|||||||  ||::|:|||||||||||||||||| |||||||||||||||||||||||||||||||:|:|||||||||:|||||||||||||||||||||||||:|||||||||| |||||||||||| ||||:|||||||||||||||||||||||||||||||||||||||||| |||||||||||: ||||||||||||:||:||||:|||:|||||||||||||||||||||||||:|| ||:||||  ||||||||||||||||||:| |||||||||||||||::||||||||||::||:|| |:: :|:|||||||||||||||::|||||||:| ||||||:||||||||||||||||||||||:||||||||||||||||||||::||::: ||::|||||||||:|||:||||::|| |||||||||| ::|: :||  :  :: : : :|| |    |:  |   | |   : ||||    : :   : :::  ::  |                                                                                                                                                        '
    '------------------------------------------------------------AAGRGAGRWAMAGCRLWVSLLLAAALACLATALWPWPQYIQTYHRRYTLYPNNFQFRYHVSSAAQAGCVVLDEAFRRYRNLLFGSGSWPRPSFSNKQQTLGKNILVVSVVTAECNEFPNLESVENYTLTINDDQCLLASETVWGALRGLETFSQLVWKSAEGTFFINKTKIKDFPRFPHRGVLLDTSRHYLPLSSILDTLDVMAYNKFNVFHWHLVDDSSFPYESFTFPELTRKGSFNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGAPGLLTPCYSGSHLSGTFGPVNPSLNSTYDFMSTLFLEISSVFPDFYLHLGGDEVDFTCWKSNPNIQAFMKKKGF-TDFKQLESFYIQTLLDIVSDYDKGYVVWQEVFDNKVKVRPDTIIQVWREEMPVEYMLEMQDITRAGFRALLSAPWYLNRVKYGPDWKDMYKVEPLAFHGTPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLWSSNLTTNIDFAFKRLSHFRCELVRRGIQAQPISVGCCEQEFEQT*ATSAEHPGGCCPLSQLR*APRRVLALREQVPGQG*SFTASRPGESTPCPCAPVTTEKEAGAGTGVQ*RSMWHFL-------------------------------------------------------------------------------------------------------------------------------------------------------'

Refining the Alignment by Extracting the Protein Sequence

Another way to refine your alignment is by using only the protein sequences. Notice that the aligned region is delimited by start ( M-methionine ) and stop ( * ) amino acids in the sequences. If the sequence is shortened so that only the translated regions are considered, then it seems likely that you will get a better alignment. Use the find command to look for the index of the start amino acid in each sequence:

humanStart = find(humanProtein == 'M',1)
humanStart = 
70
mouseStart = find(mouseProtein == 'M',1)
mouseStart = 
11

Similarly, use the find command to look for the index of the first stop occurring after the start of the translation. Special care needs to be taken because there is also a stop at the very beginning of the humanProtein sequence.

humanStop = find(humanProtein(humanStart:end)=='*',1) + humanStart - 1
humanStop = 
599
mouseStop = find(mouseProtein(mouseStart:end)=='*',1) + mouseStart - 1
mouseStop = 
539

Use these indices to truncate the sequences.

humanSeq = humanProtein(humanStart:humanStop);
humanSeqFormatted = seqdisp(humanSeq)
humanSeqFormatted = 9×70 char array
    '  1  MTSSRLWFSL LLAAAFAGRA TALWPWPQNF QTSDQRYVLY PNNFQFQYDV SSAAQPGCSV'
    ' 61  LDEAFQRYRD LLFGSGSWPR PYLTGKRHTL EKNVLVVSVV TPGCNQLPTL ESVENYTLTI'
    '121  NDDQCLLLSE TVWGALRGLE TFSQLVWKSA EGTFFINKTE IEDFPRFPHR GLLLDTSRHY'
    '181  LPLSSILDTL DVMAYNKLNV FHWHLVDDPS FPYESFTFPE LMRKGSYNPV THIYTAQDVK'
    '241  EVIEYARLRG IRVLAEFDTP GHTLSWGPGI PGLLTPCYSG SEPSGTFGPV NPSLNNTYEF'
    '301  MSTFFLEVSS VFPDFYLHLG GDEVDFTCWK SNPEIQDFMR KKGFGEDFKQ LESFYIQTLL'
    '361  DIVSSYGKGY VVWQEVFDNK VKIQPDTIIQ VWREDIPVNY MKELELVTKA GFRALLSAPW'
    '421  YLNRISYGPD WKDFYIVEPL AFEGTPEQKA LVIGGEACMW GEYVDNTNLV PRLWPRAGAV'
    '481  AERLWSNKLT SDLTFAYERL SHFRCELLRR GVQAQPLNVG FCEQEFEQT*           '

mouseSeq = mouseProtein(mouseStart:mouseStop);
mouseSeqFormatted = seqdisp(mouseSeq)
mouseSeqFormatted = 9×70 char array
    '  1  MAGCRLWVSL LLAAALACLA TALWPWPQYI QTYHRRYTLY PNNFQFRYHV SSAAQAGCVV'
    ' 61  LDEAFRRYRN LLFGSGSWPR PSFSNKQQTL GKNILVVSVV TAECNEFPNL ESVENYTLTI'
    '121  NDDQCLLASE TVWGALRGLE TFSQLVWKSA EGTFFINKTK IKDFPRFPHR GVLLDTSRHY'
    '181  LPLSSILDTL DVMAYNKFNV FHWHLVDDSS FPYESFTFPE LTRKGSFNPV THIYTAQDVK'
    '241  EVIEYARLRG IRVLAEFDTP GHTLSWGPGA PGLLTPCYSG SHLSGTFGPV NPSLNSTYDF'
    '301  MSTLFLEISS VFPDFYLHLG GDEVDFTCWK SNPNIQAFMK KKGFTDFKQL ESFYIQTLLD'
    '361  IVSDYDKGYV VWQEVFDNKV KVRPDTIIQV WREEMPVEYM LEMQDITRAG FRALLSAPWY'
    '421  LNRVKYGPDW KDMYKVEPLA FHGTPEQKAL VIGGEACMWG EYVDSTNLVP RLWPRAGAVA'
    '481  ERLWSSNLTT NIDFAFKRLS HFRCELVRRG IQAQPISVGC CEQEFEQT*            '

Align these two sequences.

[score, alignment] = nwalign(humanSeq,mouseSeq)
score = 
1.0423e+03
alignment = 3×530 char array
    'MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGFCEQEFEQT*'
    '|:: ||| |||||||:|  ||||||||| :||  :||:||||||||:| |||||| || ||||||:|||:||||||||||| :::|::|| ||:|||||||  ||::|:|||||||||||||||||| |||||||||||||||||||||||||||||||:|:|||||||||:|||||||||||||||||||||||||:|||||||||| |||||||||||| ||||:|||||||||||||||||||||||||||||||||||||||||| |||||||||||: ||||||||||||:||:||||:|||:|||||||||||||||||||||||||:|| ||:||||  ||||||||||||||||||:| |||||||||||||||::||||||||||::||:|| |:: :|:|||||||||||||||::|||||||:| ||||||:||||||||||||||||||||||:||||||||||||||||||||::||::: ||::|||||||||:|||:||||::|| |||||||||'
    'MAGCRLWVSLLLAAALACLATALWPWPQYIQTYHRRYTLYPNNFQFRYHVSSAAQAGCVVLDEAFRRYRNLLFGSGSWPRPSFSNKQQTLGKNILVVSVVTAECNEFPNLESVENYTLTINDDQCLLASETVWGALRGLETFSQLVWKSAEGTFFINKTKIKDFPRFPHRGVLLDTSRHYLPLSSILDTLDVMAYNKFNVFHWHLVDDSSFPYESFTFPELTRKGSFNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGAPGLLTPCYSGSHLSGTFGPVNPSLNSTYDFMSTLFLEISSVFPDFYLHLGGDEVDFTCWKSNPNIQAFMKKKGF-TDFKQLESFYIQTLLDIVSDYDKGYVVWQEVFDNKVKVRPDTIIQVWREEMPVEYMLEMQDITRAGFRALLSAPWYLNRVKYGPDWKDMYKVEPLAFHGTPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLWSSNLTTNIDFAFKRLSHFRCELVRRGIQAQPISVGCCEQEFEQT*'

Use the coding region information (CDS) from the GenBank data structure to find the coding region of the genes.

idx = humanHEXA.CDS.indices;
humanCodingRegion = humanHEXA.Sequence(idx(1):idx(2));
idx = mouseHEXA.CDS.indices;        
mouseCodingRegion = mouseHEXA.Sequence(idx(1):idx(2));

You can also get the translation of the coding regions from this structure.

humanTranslatedRegion = humanHEXA.CDS.translation;
mouseTranslatedRegion = mouseHEXA.CDS.translation;

Local Alignment

Instead of truncating the sequences to look for better alignment, an alternative approach is to use a local alignment. The function swalign performs local alignment using the Smith-Waterman algorithm. This shows a very good alignment for the whole coding region and reasonable similarity for a few residues beyond at both the ends of the gene.

[score, localAlignment] = swalign(humanProtein,mouseProtein)
score = 
1057
localAlignment = 3×547 char array
    'RGDQR-AMTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGFCEQEFEQT*APGTEEGAGC'
    '||  | ||:: ||| |||||||:|  ||||||||| :||  :||:||||||||:| |||||| || ||||||:|||:||||||||||| :::|::|| ||:|||||||  ||::|:|||||||||||||||||| |||||||||||||||||||||||||||||||:|:|||||||||:|||||||||||||||||||||||||:|||||||||| |||||||||||| ||||:|||||||||||||||||||||||||||||||||||||||||| |||||||||||: ||||||||||||:||:||||:|||:|||||||||||||||||||||||||:|| ||:||||  ||||||||||||||||||:| |||||||||||||||::||||||||||::||:|| |:: :|:|||||||||||||||::|||||||:| ||||||:||||||||||||||||||||||:||||||||||||||||||||::||::: ||::|||||||||:|||:||||::|| |||||||||| ::|: :||'
    'RGAGRWAMAGCRLWVSLLLAAALACLATALWPWPQYIQTYHRRYTLYPNNFQFRYHVSSAAQAGCVVLDEAFRRYRNLLFGSGSWPRPSFSNKQQTLGKNILVVSVVTAECNEFPNLESVENYTLTINDDQCLLASETVWGALRGLETFSQLVWKSAEGTFFINKTKIKDFPRFPHRGVLLDTSRHYLPLSSILDTLDVMAYNKFNVFHWHLVDDSSFPYESFTFPELTRKGSFNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGAPGLLTPCYSGSHLSGTFGPVNPSLNSTYDFMSTLFLEISSVFPDFYLHLGGDEVDFTCWKSNPNIQAFMKKKGF-TDFKQLESFYIQTLLDIVSDYDKGYVVWQEVFDNKVKVRPDTIIQVWREEMPVEYMLEMQDITRAGFRALLSAPWYLNRVKYGPDWKDMYKVEPLAFHGTPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLWSSNLTTNIDFAFKRLSHFRCELVRRGIQAQPISVGCCEQEFEQT*ATSAEHPGGC'

Alignment of Complementary DNA Sequences

All the sequence alignment functions provided in MATLAB can be customized. For example, by modifying the rows and columns of a scoring matrix you can align sequences by complement and not by identity. In this case you can reorder the NUC44 scoring matrix; a positive score is given for complements while a negative score is given otherwise. The first 30 nucleotides from the mouse HEXA gene will be aligned to its complement.

[M, info] = nuc44;
map = nt2int(seqcomplement(info.Order))
map = 1×15 uint8 row vector

    4    3    2    1    6    5    8    7    9   10   14   13   12   11   15

Mc = M(:,map)
Mc = 15×15

    -4    -4    -4     5    -4     1     1    -4    -4     1    -1    -1    -1    -4    -2
    -4    -4     5    -4     1    -4     1    -4     1    -4    -1    -1    -4    -1    -2
    -4     5    -4    -4    -4     1    -4     1     1    -4    -1    -4    -1    -1    -2
     5    -4    -4    -4     1    -4    -4     1    -4     1    -4    -1    -1    -1    -2
    -4     1    -4     1    -4    -1    -2    -2    -2    -2    -1    -3    -1    -3    -1
     1    -4     1    -4    -1    -4    -2    -2    -2    -2    -3    -1    -3    -1    -1
     1     1    -4    -4    -2    -2    -4    -1    -2    -2    -3    -3    -1    -1    -1
    -4    -4     1     1    -2    -2    -1    -4    -2    -2    -1    -1    -3    -3    -1
    -4     1     1    -4    -2    -2    -2    -2    -1    -4    -1    -3    -3    -1    -1
     1    -4    -4     1    -2    -2    -2    -2    -4    -1    -3    -1    -1    -3    -1
    -1    -1    -1    -4    -1    -3    -3    -1    -1    -3    -2    -2    -2    -1    -1
    -1    -1    -4    -1    -3    -1    -3    -1    -3    -1    -2    -2    -1    -2    -1
    -1    -4    -1    -1    -1    -3    -1    -3    -3    -1    -2    -1    -2    -2    -1
    -4    -1    -1    -1    -3    -1    -1    -3    -1    -3    -1    -2    -2    -2    -1
    -2    -2    -2    -2    -1    -1    -1    -1    -1    -1    -1    -1    -1    -1    -1
      ⋮

[score, compAlignment] = nwalign(mouseHEXA.Sequence(1:30), ...
    seqcomplement(mouseHEXA.Sequence(1:30)), 'SCORINGMATRIX', ...
        Mc, 'ALPHABET', 'NT')
score = 
150
compAlignment = 3×30 char array
    'GCTGCTGGAAGGGGAGCTGGCCGGTGGGCC'
    '::::::::::::::::::::::::::::::'
    'CGACGACCTTCCCCTCGACCGGCCACCCGG'

close all;